Gene Bio Systems
Recombinant Xenopus tropicalis ER lumen protein retaining receptor 3(kdelr3)
Recombinant Xenopus tropicalis ER lumen protein retaining receptor 3(kdelr3)
SKU:CSB-CF714897XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q66JF2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNVFRISGDVSHLLAIIILLLKMWKSKSCAGISGKSQLLFALVFTTRYLDLFTVFISAYN TVMKIVFLVCAYVTVYLIYGKFRKAYDSENDTFRLEFLLVPVIGLSFLENYEFTPLEILW TFSIYLESVAILPQLFMISKTGEAESITTHYLFFLGLYRVLYLANWIWRYHTEKFYDQIA VVSGVVQTIFYFDFFYLYITKVLKGKKLSLPMPV
Protein Names:Recommended name: ER lumen protein retaining receptor 3 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 3 Short name= KDEL receptor 3
Gene Names:Name:kdelr3 ORF Names:TNeu014i13.1
Expression Region:1-214
Sequence Info:full length protein
