Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis ER lumen protein retaining receptor 1(kdelr1)

Recombinant Xenopus tropicalis ER lumen protein retaining receptor 1(kdelr1)

SKU:CSB-CF716821XBF

Regular price ¥280,000 JPY
Regular price Sale price ¥280,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q5XHA2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFRFLGDISHLSAILILLLKIWKSRSCAGISGKSQLLFAIVFTTRYLDLFTNFISLYN TSMKMVYVASSYATIWMIYSKFKATYDGNHDTFRVEFLIVPTAILAFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGIYRALYLFNWIWRYQFEGFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA

Protein Names:Recommended name: ER lumen protein retaining receptor 1 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1 Short name= KDEL receptor 1

Gene Names:Name:kdelr1 ORF Names:TGas070a01.1

Expression Region:1-212

Sequence Info:full length protein

View full details