Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis CD99 antigen-like protein 2(cd99l2)

Recombinant Xenopus tropicalis CD99 antigen-like protein 2(cd99l2)

SKU:CSB-CF004975XBF

Regular price ¥275,000 JPY
Regular price Sale price ¥275,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:B1H3G4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DDFDLYDALGDPTEKPKPKPPKPPKSPTHDSGDLDLSDFFDTPVKTTTKSPRLPPKQPDLRFSTTTKKPRTTKIPPKKSDPNDFDLSDALDGNNGKGDISDSDLDDILNDGYNPDKKKGGGGGGGGGGRATGQGDNDGSDTGFGSQAETGTIAGIASALAMALIGAVSSYISYQQKKFCFSIQEGLNAEYVKGEHMEAVVSEEPQVKYSVVESQSAIP

Protein Names:Recommended name: CD99 antigen-like protein 2 Alternative name(s): CD_antigen= CD99

Gene Names:Name:cd99l2

Expression Region:24-241

Sequence Info:full length protein

View full details