Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Zinc finger protein-like 1(zfpl1)

Recombinant Xenopus laevis Zinc finger protein-like 1(zfpl1)

SKU:CSB-CF026462XBE

Regular price ¥297,200 JPY
Regular price Sale price ¥297,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:A1L2S8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNTLLSSKETARLVCYDLFHWSCLNDLATQQPPNTAPAGYRCPSCQGPVFPPNNLVSPVAATLREKLSTVNWARAGLGLPLIEVAEPVDDTMSHDETDYRDWSVVNSSSDNLSETPETTSQTGYTYNSVAPGAVQQSLNGNMSQDHAVTIRDTGSESVPFNAASSPRKVYDTRENARGQDAVIDFDDDKYRRRPTLNWLARILRNRSGSKSRPASSMQRFLVILIIGVLGFLTLILLMSKLGRASADNDPNLDPLLNPHIHVGKE

Protein Names:Recommended name: Zinc finger protein-like 1

Gene Names:Name:zfpl1

Expression Region:1-320

Sequence Info:full length protein

View full details