Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis UPF0542 protein C5orf43 homolog

Recombinant Xenopus laevis UPF0542 protein C5orf43 homolog

SKU:CSB-CF430154XBE

Regular price ¥253,700 JPY
Regular price Sale price ¥253,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:A9JTJ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIDTLKGWAEYLVEWAAKDPYGFLITVLLALTPLFLASAVLSWKMAKMIEAKERDQKKKQ KRQENIAKAKRTKKD

Protein Names:Recommended name: UPF0542 protein C5orf43 homolog

Gene Names:

Expression Region:1-75

Sequence Info:full length protein

View full details