Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Transmembrane protein 150B-B(tmem150b-b)

Recombinant Xenopus laevis Transmembrane protein 150B-B(tmem150b-b)

SKU:CSB-CF681180XBE

Regular price ¥277,800 JPY
Regular price Sale price ¥277,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q4V7T3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVSNGSVNLSDGFPYISVSGTYPPQSCVFGQVLNVGAMLAVWISVIRFQQIRDYNCHSV LNSVSLATGILCALGTSIVGNFQQSNQLQTHLAGAFLAFIIGNVYFWMQTALTYMVKPKH GGCYIGPIRFCLSIACTALIVAMAVFLKMNMKSVSAICEWIVAMILFLLYGLFAVDFWHL DGHFFHVKKRRTVIPNEMEVSTVTLSI

Protein Names:Recommended name: Transmembrane protein 150B-B Alternative name(s): Transmembrane protein 224-B

Gene Names:Name:tmem150b-b Synonyms:tmem224-b

Expression Region:25-231

Sequence Info:full length protein

View full details