Gene Bio Systems
Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit gamma(fxyd2)
Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit gamma(fxyd2)
SKU:CSB-CF009090XBE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:O13001
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADAQDDMSQMQDKFTYDYETIRKGGLIFAAIAFVVGMLIIFSGRFRCGRKKQLRALNDD M
Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit gamma Short name= Na(+)/K(+) ATPase subunit gamma Alternative name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain
Gene Names:Name:fxyd2
Expression Region:1-61
Sequence Info:full length protein
