Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Protein Mpv17(mpv17)

Recombinant Xenopus laevis Protein Mpv17(mpv17)

SKU:CSB-CF727721XBE

Regular price ¥271,900 JPY
Regular price Sale price ¥271,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q66GV0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGLWRAYQRLLGAHPWKVQIVTAGSLVGVGDVISQQLLERKGLKGHSIERTVKMMGIGF CFVGPVVGGWYKILDRIIPGSGKPVALKKMLLDQVAFAPCFLGCFLSIASALNGLSGEQI WGKLKRDYKDALITNYYIWPAVQVANFYFIPLYHRLAVVQFVAIIWNSYLSWKANKS

Protein Names:Recommended name: Protein Mpv17

Gene Names:Name:mpv17

Expression Region:1-177

Sequence Info:full length protein

View full details