Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Methyltransferase-like protein 23(mettl23)

Recombinant Xenopus laevis Methyltransferase-like protein 23(mettl23)

SKU:CSB-CF718770XBE

Regular price ¥284,100 JPY
Regular price Sale price ¥284,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6DJF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGEENEQRIGERVYEFLRREGKDEQKMRVTIPEVLNCQYGMYVWPCAVVLAQYLWYHRKN LADKRVLEVGAGVSLPGILAAKCGAKVILSDSAEMPQCLENCRRSCKMNNIVGVPVIGLT WGEVSPDLLDLPPIDIILGSDVFYEPKDFEDILLTVRFLMERMPQAEFWTTYQVRSADWS VEALLCKWNLKCTNVPLKTFDADNECLAGSELPGRHTVQMMIITLDRKGAGHTG

Protein Names:Recommended name: Methyltransferase-like protein 23 EC= 2.1.1.-

Gene Names:Name:mettl23

Expression Region:1-234

Sequence Info:full length protein

View full details