Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Melatonin receptor type 1A X2.0

Recombinant Xenopus laevis Melatonin receptor type 1A X2.0

SKU:CSB-CF342722XBE

Regular price ¥267,100 JPY
Regular price Sale price ¥267,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:P51048

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HSSWYNRLFSNSGTICYVGLVWVLALGAILPNLFVGSLRCDPRIFSCTFAQYVSSYYTIA VVIFHFFLPIGVVSYCYLRIWVLVLNIRHRVKPDRHLHHQTWPYNIHGFITMFVVFVLFA VCWGPLNIIGLTVAIYPPLGDSIPQWLFVASYF

Protein Names:Recommended name: Melatonin receptor type 1A X2.0 Short name= Mel-1A-R X2.0 Short name= Mel1a receptor X2.0

Gene Names:

Expression Region:1-153

Sequence Info:full length protein

View full details