Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Immediate early response 3-interacting protein 1(ier3ip1)

Recombinant Xenopus laevis Immediate early response 3-interacting protein 1(ier3ip1)

SKU:CSB-CF658947XBE

Regular price ¥254,000 JPY
Regular price Sale price ¥254,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q3B8G7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFTLYTLLQAALLCVNAVAVLHEERFLSKIGWGVDHGIGGFGEEPGMKSQLMNLIRSVR TVMRVPLIIVNSVTIVLLLLFG

Protein Names:Recommended name: Immediate early response 3-interacting protein 1

Gene Names:Name:ier3ip1

Expression Region:1-82

Sequence Info:full length protein

View full details