Gene Bio Systems
Recombinant Xenopus laevis ER lumen protein retaining receptor 2(kdelr2)
Recombinant Xenopus laevis ER lumen protein retaining receptor 2(kdelr2)
SKU:CSB-CF773845XBE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q7ZXS5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNVFRLSGDLCHLAAIIILLLKIWNSRSCAGISGKSQLLFAMVFTTRYLDLFTSFISLYN TSMKVIYMGCAYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSVLVNHDFSPLEILW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLFNWIWRFSFEGFFDLIA IVAGVVQTILYCDFFYLYVTKVLKGKKLSLPA
Protein Names:Recommended name: ER lumen protein retaining receptor 2 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 2 Short name= KDEL receptor 2
Gene Names:Name:kdelr2
Expression Region:1-212
Sequence Info:full length protein
