Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis ER lumen protein retaining receptor 1-B(kdelr1-b)

Recombinant Xenopus laevis ER lumen protein retaining receptor 1-B(kdelr1-b)

SKU:CSB-CF718079XBE

Regular price ¥279,000 JPY
Regular price Sale price ¥279,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q68ES4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFRFLGDISHLSAIIILLLKIWKSRSCAGISGKSQLLFAIVFTTRYLDLFTNFISFYN TSMKVVYVASSYATVWMIYSKFKATYDGNHDTFRVEFLIVPTAILSFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGIYRTLYLFNWIWRYQFEEFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA

Protein Names:Recommended name: ER lumen protein retaining receptor 1-B Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1-B Short name= KDEL receptor 1-B

Gene Names:Name:kdelr1-b

Expression Region:1-212

Sequence Info:full length protein

View full details