Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-A(rnf152-a)

Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-A(rnf152-a)

SKU:CSB-CF764103XBE

Regular price ¥278,200 JPY
Regular price Sale price ¥278,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GND7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METLSQDSLLECQICFNYYSPRRRPKLLDCKRTCCSVCLQQMRACQKDLRCPWCRGVTKL PPGYSVSQLPDDPDVVAVITIPHASENTPVFIKLPSNGCYMWPLPVSKERALLPGDIGCR LLPGNQQKPVTVVTMPMEQQPLHGNIPQDIVEEEHERRGVVKSSTWSGICTVILVACVLV FLLGIVLHNMSCISKRFTVISCG

Protein Names:Recommended name: E3 ubiquitin-protein ligase rnf152-A EC= 6.3.2.- Alternative name(s): RING finger protein 152-A

Gene Names:Name:rnf152-a Synonyms:rnf152

Expression Region:1-203

Sequence Info:full length protein

View full details