Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH3(41336)

Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH3(41336)

SKU:CSB-CF607991XBE

Regular price ¥286,400 JPY
Regular price Sale price ¥286,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q0IH10

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTSRCSHLPEVLPDCTSSAPSGKTVEDCSSLVNGQPQYVMQVSAKDGQLLSTVVRTLTT QSSFNDHPMCRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFS VERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLE AVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILVIPKSANLPSAQQSLLGL HSFKRNSKETIV

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH3 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 3 Membrane-associated RING-CH protein III Short name= MARCH-III

Gene Names:Name:march3

Expression Region:1-252

Sequence Info:full length protein

View full details