Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xanthomonas campestris pv. campestris UPF0059 membrane protein xcc-b100_4276 (xcc-b100_4276)

Recombinant Xanthomonas campestris pv. campestris UPF0059 membrane protein xcc-b100_4276 (xcc-b100_4276)

SKU:CSB-CF532334XAZ

Regular price ¥271,500 JPY
Regular price Sale price ¥271,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xanthomonas campestris pv. campestris (strain B100)

Uniprot NO.:B0RYW0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPLSIVLLGFAMSTDAFAAAIGKGAAMRRPRWRDAVRAGLVFGCIEAITPVIGWMLGRA ASDYLAAFDHWIAFGLLGALGAHMIVAGLRNESEVDEALRDTPKRYGLLALAATGFATSI DAMAVGVSLAFLDVHIGVVAAVVGLCTLSMVTAGVMLGRALGALIGKRTEILGGVILILI GSTILYEHLSGAA

Protein Names:Recommended name: UPF0059 membrane protein xcc-b100_4276

Gene Names:Ordered Locus Names:xcc-b100_4276

Expression Region:1-193

Sequence Info:full length protein

View full details