Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xanthomonas campestris pv. campestris UPF0059 membrane protein XC_4166(XC_4166)

Recombinant Xanthomonas campestris pv. campestris UPF0059 membrane protein XC_4166(XC_4166)

SKU:CSB-CF706231XAF

Regular price ¥271,400 JPY
Regular price Sale price ¥271,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xanthomonas campestris pv. campestris (strain 8004)

Uniprot NO.:Q4UP19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPLSIVLLGFAMSTDAFAAAIGKGAAMRRPRWRDAVRAGLVFGCIEAITPVIGWMLGRA ASDYLAAFDHWIAFGLLGALGAHMIVAGLRNESEVDEALRDTPKRYGLLALAATGFATSI DAMAVGVSLAFLDVHIGVVAAVVGLCTLSMVTAGVMLGRALGALIGKRAEILGGVILILI GSTILYEHLSGAA

Protein Names:Recommended name: UPF0059 membrane protein XC_4166

Gene Names:Ordered Locus Names:XC_4166

Expression Region:1-193

Sequence Info:full length protein

View full details