Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xanthomonas campestris pv. campestris Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Recombinant Xanthomonas campestris pv. campestris Sulfoxide reductase heme-binding subunit YedZ(yedZ)

SKU:CSB-CF531441XAZ

Regular price ¥272,700 JPY
Regular price Sale price ¥272,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xanthomonas campestris pv. campestris (strain B100)

Uniprot NO.:B0RUW5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKKSVSVIAAKTAVHAAVLAPIALLGWQFWQVWQQGSDALGADPVAEIEHRTGLWALRL LLITLAITPLRQLTGQAVLIRFRRMLGLYTFFYASVHLTAYLWLDLRGFWTQIFEEIVKR PYITVGFTAWLLLVPLAITSTQGWMRRLKRNWGRLHMLIYPIGLLAVLHFWWLVKSDIRE PALYAGILALLLGWRVWKRLSARRTTARHSAPPPATPR

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:xcc-b100_2673

Expression Region:1-218

Sequence Info:full length protein

View full details