Skip to product information
1 of 1

Gene Bio Systems

Recombinant Volvox carteri Cytochrome b6-f complex subunit petO, chloroplastic(PETO)

Recombinant Volvox carteri Cytochrome b6-f complex subunit petO, chloroplastic(PETO)

SKU:CSB-CF890301VDT

Regular price ¥267,400 JPY
Regular price Sale price ¥267,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Volvox carteri (Green alga)

Uniprot NO.:Q9SBM5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GVVLQQPELKKVFQDDAPAPAPVKREFKGLAPPSLPKPVEAPKPAAVAAAPEKKEEVKES GSDLDPRSIALPGALALTIGGFFAASKIDTSFNEWFIEAVVKDSNNYAGYEATLKTDAGV VFPKAATAGTKKVKAATGSKKGGFPFGGKK

Protein Names:Recommended name: Cytochrome b6-f complex subunit petO, chloroplastic Alternative name(s): Cytochrome b6-f complex subunit V Short name= suV Cytochrome b6-f-associated phosphoprotein

Gene Names:Name:PETO

Expression Region:54-203

Sequence Info:full length protein

View full details