Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera CASP-like protein VIT_12s0028g03760 (VIT_12s0028g03760)

Recombinant Vitis vinifera CASP-like protein VIT_12s0028g03760 (VIT_12s0028g03760)

SKU:CSB-CF415855VFQ

Regular price ¥269,200 JPY
Regular price Sale price ¥269,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7PJ32

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKNTDRICFLVLRLLAFGATLSAAIVMATSHERTTYLSLSIEAKYSHTPAFKYFVIANA IGSAYSLLLLFLPSHGSLWPLVIASDVVITMFLTSSISAALSIAYVGKKGNSYAGWLPIC DQVPNYCNHVTGALAAGFIGVVLYMVLLQYSIYTKCCKSSS

Protein Names:Recommended name: CASP-like protein VIT_12s0028g03760

Gene Names:Ordered Locus Names:VIT_12s0028g03760 ORF Names:GSVIVT00018576001, GSVIVT01020544001, VIT_00020544001, Vv12s0028g03760

Expression Region:1-161

Sequence Info:full length protein

View full details