Gene Bio Systems
Recombinant Vicia faba Legumin type B(LEB6),partial
Recombinant Vicia faba Legumin type B(LEB6),partial
SKU:CSB-YP323408VFJ
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P16079
Gene Names: LEB6
Organism: Vicia faba (Broad bean) (Faba vulgaris)
AA Sequence: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN
Expression Region: 1-148aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 19 kDa
Alternative Name(s): Legumin type B acidic chain
Relevance: This protein found in the seeds of many leguminous and non-leguminous plants is the source of sulfur-containing amino acids in seed meals.
Reference: "The legumin gene family: structure and evolutionary implications of Vicia faba B-type genes and pseudogenes." Heim U., Schubert R., Baeumlein H., Wobus U. Plant Mol. Biol. 13:653-663(1989)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.