Gene Bio Systems
Recombinant Vibrio vulnificus UPF0299 membrane protein VV1471(VV1471)
Recombinant Vibrio vulnificus UPF0299 membrane protein VV1471(VV1471)
SKU:CSB-CF752222VCQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio vulnificus (strain YJ016)
Uniprot NO.:Q7MLF6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFSLKDLFGLVVSFGLIFLALTIGSGIQHWTGTSVPGSVIGMLVLFVSMAIGLVKVEWV KPGASLLIRYMILLFVPISVGLMEHFDMLIANALPIIASAIGGSLIVLVSLGWLLQRILG KEA
Protein Names:Recommended name: UPF0299 membrane protein VV1471
Gene Names:Ordered Locus Names:VV1471
Expression Region:1-123
Sequence Info:full length protein
