Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio vulnificus UPF0208 membrane protein VV2132(VV2132)

Recombinant Vibrio vulnificus UPF0208 membrane protein VV2132(VV2132)

SKU:CSB-CF759291VCQ

Regular price ¥267,100 JPY
Regular price Sale price ¥267,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio vulnificus (strain YJ016)

Uniprot NO.:Q7MJM9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNKVGLAHSLRDGQKYMDTWPMRKELSAIFPEQRIIKATRFGIKVMPAIAAISVLTQMA FNNYQALPQAIVMALFALSLPLQGMWWLGHRSNTQLPPALATWYRELHQKIVESGSALEP LKSRPRYKELAHTLNRAFRHLDKSALERWF

Protein Names:Recommended name: UPF0208 membrane protein VV2132

Gene Names:Ordered Locus Names:VV2132

Expression Region:1-150

Sequence Info:full length protein

View full details