Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio splendidus UPF0397 protein VS_II0189 (VS_II0189)

Recombinant Vibrio splendidus UPF0397 protein VS_II0189 (VS_II0189)

SKU:CSB-CF491517VFH

Regular price ¥273,100 JPY
Regular price Sale price ¥273,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32))

Uniprot NO.:B7VQF8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFSAKTVVVIAIGAALYGIGGLPMFGVPVFANTTLKPAMAVLALFSVLFGPIVGFLVGF IGHWVTDLFAGWGVWLTWVLGSGIVGMVIGLFPMMTKNRLQQGELPMKDFALFVVLALAG NVVGYGSSAFLDTILYAEPFTKVFTQLSIIAAGNTILIAVVGFLILKSVAKRNKQSRNLT EA

Protein Names:Recommended name: UPF0397 protein VS_II0189

Gene Names:Ordered Locus Names:VS_II0189

Expression Region:1-182

Sequence Info:full length protein

View full details