Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio harveyi Electron transport complex protein RnfA(rnfA)

Recombinant Vibrio harveyi Electron transport complex protein RnfA(rnfA)

SKU:CSB-CF417748VEA

Regular price ¥272,100 JPY
Regular price Sale price ¥272,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Uniprot NO.:A7MVC5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTEYILLLVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAYLVE SYVLRPLGIEYLRTMSFILVIAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINENHNFIESIIYGFGAAVGFSLVLILFASMRERIAAADVPVPFRGASIAMITAGLM SLAFMGFTGLVK

Protein Names:Recommended name: Electron transport complex protein RnfA

Gene Names:Name:rnfA Ordered Locus Names:VIBHAR_02964

Expression Region:1-192

Sequence Info:full length protein

View full details