Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio fischeri UPF0208 membrane protein VFMJ11_0876 (VFMJ11_0876)

Recombinant Vibrio fischeri UPF0208 membrane protein VFMJ11_0876 (VFMJ11_0876)

SKU:CSB-CF480650VFC

Regular price ¥267,700 JPY
Regular price Sale price ¥267,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio fischeri (strain MJ11)

Uniprot NO.:B5FC41

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSENGFLFRFRDGQTYMDTWPERKELAPMFPEQRVIKATKFAVKVMPAVAVISVLTQMVF NNTAGLPQAIIIALFAISMPLQGFWWLGNRANTKLPPALASWYRELYQKIIESGAALEPM KSQPRYKELANILNKAFKQLDKTALERWF

Protein Names:Recommended name: UPF0208 membrane protein VFMJ11_0876

Gene Names:Ordered Locus Names:VFMJ11_0876

Expression Region:1-149

Sequence Info:full length protein

View full details