Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio cholerae serotype O1 Na(+)-translocating NADH-quinone reductase subunit C

Recombinant Vibrio cholerae serotype O1 Na(+)-translocating NADH-quinone reductase subunit C

SKU:CSB-CF313682VEX

Regular price ¥288,100 JPY
Regular price Sale price ¥288,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Uniprot NO.:P0C6E0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASNNDSIKKTLFVVIALSLVCSIIVSAAAVGLRDKQKENAALDKQSKILQVAGIEAKGSK QIVELFNKSIEPRLVDFNTGDFVEGDAANYDQRKAAKEASESIKLTAEQDKAKIQRRANV GVVYLVKDGDKTSKVILPVHGNGLWSMMYAFVAVETDGNTVSGLTYYEQGETPGLGGEVE NPAWRAQWVGKKLFDENHKPAIKIVKGGAPQGSEHGVDGLSGATLTSNGVQNTFDFWLGD MGFGPFLTKVRDGGLN

Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit C Short name= Na(+)-NQR subunit C Short name= Na(+)-translocating NQR subunit C EC= 1.6.5.- Alternative name(s): NQR complex subunit C NQR-1 subunit C

Gene Names:Name:nqrC Ordered Locus Names:VC_2293

Expression Region:2-257

Sequence Info:full length protein

View full details