Recombinant Vibrio cholerae serotype O1 Accessory cholera enterotoxin(ace)

SKU: CSB-CF330882VEX

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Uniprot NO.:P38441

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLMMDTLYDWLIDGFTWLVIKLGIMWIESKIFVIQFFWEMSQKVIDMFTIYPLIQQAIDM LPPQYSGFLFFLGLDQALAIVLQALMTRFALRALNL

Protein Names:Recommended name: Accessory cholera enterotoxin Short name= Ace

Gene Names:Name:ace Ordered Locus Names:VC_1459

Expression Region:1-96

Sequence Info:full length protein