Skip to product information
1 of 1

Gene Bio Systems

Recombinant Verticillium albo-atrum Signal peptidase complex catalytic subunit SEC11(SEC11)

Recombinant Verticillium albo-atrum Signal peptidase complex catalytic subunit SEC11(SEC11)

SKU:CSB-CF513928VES

Regular price ¥271,300 JPY
Regular price Sale price ¥271,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Verticillium albo-atrum (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt)

Uniprot NO.:C9S8G0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSSLKNPRQAAAQLLNFGLILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLRETDVGEVVVYNVKDKDIPIVHRIVRKFGAGASAKLLTKGDNNAADDTELYA RGQDYLERQDIIGSVVAYIPFVGYVTILLSEHPWLKTVMLGIMGLVVVLQRE

Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I

Gene Names:Name:SEC11 ORF Names:VDBG_01459

Expression Region:1-172

Sequence Info:full length protein

View full details