Gene Bio Systems
Recombinant Variola virus Late protein H7 (H7R)
Recombinant Variola virus Late protein H7 (H7R)
SKU:CSB-CF329225VAR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Uniprot NO.:P33063
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEMDKRMKSLAMTAFFGELTTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDTYKA SQYLDLPLTPISGDECKTHASSIAKQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISQDTEKLKIALAKGIDYEYIKDAC
Protein Names:Recommended name: Late protein H7
Gene Names:ORF Names:H7R
Expression Region:1-146
Sequence Info:full length protein
