Skip to product information
1 of 1

Gene Bio Systems

Recombinant Varicella-zoster virus Glycoprotein N(gN)

Recombinant Varicella-zoster virus Glycoprotein N(gN)

SKU:CSB-CF734369VAP

Regular price ¥217,500 JPY
Regular price Sale price ¥217,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)

Uniprot NO.:Q65ZG0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EPNFAERNFWHASCSARGVYIDGSMITTLFFYASLLGVCVALISLAYHACFRLFTRSVLR STW

Protein Names:Recommended name: Glycoprotein N Short name= gN

Gene Names:Name:gN ORF Names:9A

Expression Region:25-87

Sequence Info:full length protein

View full details