Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Protein F9 (F9L)

Recombinant Vaccinia virus Protein F9 (F9L)

SKU:CSB-CF335036VAI

Regular price ¥272,000 JPY
Regular price Sale price ¥272,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Uniprot NO.:P24361

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAETKEFKTLYNLFIDSYLQKLAQHSIPTNVTCAIHIGEVIGQFKNCALRITNKCMSNSR LSFTLMVESFIEVISLLPEKDRRRIAEEIGIDLDDVPSAVSKLEKNCNAYAEVNNIIDIQ KLDIGECSAPPGQHMLLQIVNTGSAERNCGLQTIVKSLNKIYVPPIIENRLPYYDPWFLV GVAIILVIFTVAICSIRRNLALKYRYGTFLYV

Protein Names:Recommended name: Protein F9

Gene Names:ORF Names:F9L

Expression Region:1-212

Sequence Info:full length protein

View full details