Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Protein A33 (A33R)

Recombinant Vaccinia virus Protein A33 (A33R)

SKU:CSB-CF300755VAA

Regular price ¥269,100 JPY
Regular price Sale price ¥269,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Copenhagen) (VACV)

Uniprot NO.:P68616

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Protein Names:Recommended name: Protein A33

Gene Names:ORF Names:A33R

Expression Region:1-185

Sequence Info:full length protein

View full details