Skip to product information
1 of 1

Gene Bio Systems

Recombinant V-type proton ATPase 16 kDa proteolipid subunit 2-3(vha-2)

Recombinant V-type proton ATPase 16 kDa proteolipid subunit 2-3(vha-2)

SKU:CSB-CF717207CXX

Regular price ¥268,900 JPY
Regular price Sale price ¥268,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:Q612A5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYDLETAEHAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVI PVIMAGIIGIYGLVVAMVLKGKVQAASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVG DAGVRGTAQQPRLFVGMILILIFSEVLGLYGMIVALILGTS

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit 2/3 Short name= V-ATPase 16 kDa proteolipid subunit 2/3 Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit 2/3

Gene Names:Name:vha-2 ORF Names:CBG10000 ANDName: vha-3ORF Names: CBG16825

Expression Region:1-161

Sequence Info:full length protein

View full details