Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ureaplasma parvum serovar 3 UPF0154 protein UPA3_0273 (UPA3_0273)

Recombinant Ureaplasma parvum serovar 3 UPF0154 protein UPA3_0273 (UPA3_0273)

SKU:CSB-CF539101UBK

Regular price ¥260,200 JPY
Regular price Sale price ¥260,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)

Uniprot NO.:B1AIQ4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFSSFIFKVSDVFKSVIHEASDVVTKADLDNANAHTHSLAVGLGIGIVLFLIAGLIIGY FISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEIYNRAVKQK

Protein Names:Recommended name: UPF0154 protein UPA3_0273

Gene Names:Ordered Locus Names:UPA3_0273

Expression Region:1-109

Sequence Info:full length protein

View full details