Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU041(UU041)

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU041(UU041)

SKU:CSB-CF865494UAO

Regular price ¥261,500 JPY
Regular price Sale price ¥261,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ureaplasma parvum serovar 3 (strain ATCC 700970)

Uniprot NO.:Q9PRA4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSLPVIILVIGIFGSIFLVIGYIPQVIKVIKTKRTDGISLTFLISLNIACFLFVIYSIL VMIFNKHNGIPTALPLCLANTIVGILGLVILIYKVKNIKKAKLYLMDEKTYYEKYVLNNL

Protein Names:Recommended name: Uncharacterized protein UU041

Gene Names:Ordered Locus Names:UU041

Expression Region:1-120

Sequence Info:full length protein

View full details