Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0299 membrane protein YPTB1529(YPTB1529)

Recombinant UPF0299 membrane protein YPTB1529(YPTB1529)

SKU:CSB-CF734464YAH

Regular price ¥263,900 JPY
Regular price Sale price ¥263,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pseudotuberculosis

Uniprot NO.:Q66C77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRNMMSLCWQYLRAFTIIYLCLWAGKALALLLPIVIPGSIIGMLILFVLLTLQILPSPWV KPSCQLLIRYMALLFVPIGVGVMQYYEQLTKQFGPIVVSCFISTLIVMLVVAYSSHYVHR DRKVISPSTPTEGEK

Protein Names:Recommended name: UPF0299 membrane protein YPTB1529

Gene Names:Ordered Locus Names:YPTB1529

Expression Region:1-135

Sequence Info:full length protein

View full details