Gene Bio Systems
Recombinant UPF0060 membrane protein ynfA(ynfA)
Recombinant UPF0060 membrane protein ynfA(ynfA)
SKU:CSB-CF371789EJE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O1:K1 / APEC
Uniprot NO.:A1ABC7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALIWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT
Protein Names:Recommended name: UPF0060 membrane protein ynfA
Gene Names:Name:ynfA Ordered Locus Names:Ecok1_14730 ORF Names:APECO1_665
Expression Region:1-108
Sequence Info:full length protein
