Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0041 protein R07E5.13(R07E5.13)

Recombinant UPF0041 protein R07E5.13(R07E5.13)

SKU:CSB-CF638610CXY

Regular price ¥269,200 JPY
Regular price Sale price ¥269,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q21828

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSRVISKVTTYFKQHSTAEWKHYFLSTHFWGPVANWGLPLAALGDLKKNPDMISGPMTSA LLIYSSVFMRFAWHVQPRNLLLFACHFANFSAQGAQLGRFVNHNYLHYVEDPVHHKLMMK KEVLEHEHDAERVSLFLWYPFFEFLGNFRKNKLNKNKFMI

Protein Names:Recommended name: UPF0041 protein R07E5.13

Gene Names:ORF Names:R07E5.13

Expression Region:1-160

Sequence Info:full length protein

View full details