Skip to product information
1 of 1

Gene Bio Systems

Recombinant Universal stress protein B(uspB)

Recombinant Universal stress protein B(uspB)

SKU:CSB-CF300690SWW

Regular price ¥259,400 JPY
Regular price Sale price ¥259,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella typhi

Uniprot NO.:P67687

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQVRLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH

Protein Names:Recommended name: Universal stress protein B

Gene Names:Name:uspB Ordered Locus Names:STY4213, t3926

Expression Region:1-111

Sequence Info:full length protein

View full details