Skip to product information
1 of 1

Gene Bio Systems

Recombinant Universal stress protein A(uspA)

Recombinant Universal stress protein A(uspA)

SKU:CSB-EP820596SWW

Regular price ¥190,400 JPY
Regular price Sale price ¥190,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: Q8Z268

Gene Names: uspA

Organism: Salmonella typhi

AA Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Expression Region: 2-144aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 19.9 kDa

Alternative Name(s):

Relevance: Required for resistance to DNA-damaging agents.

Reference: "Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18."Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337(2003) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details