Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncinocarpus reesii Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Uncinocarpus reesii Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF503994UBH

Regular price ¥273,900 JPY
Regular price Sale price ¥273,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Uncinocarpus reesii (strain UAMH 1704)

Uniprot NO.:C4JHR1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDRPLPSSFDPYNSYLLRILLCSVLPVQFLAVHELITRPIPAGCLATSYALLRAYKSMK AGDSAQLNRMFRFRIYAQAFTLLAGVGGGFYYQAERAQRKELERAVADKKAQAKRDAWLR ELEIRDQEDREWRERHEAVGKAAKEAGNKPKEANLDAPKVPTKESEEAKPTGGILDAVKS LGKEK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:UREG_02747

Expression Region:1-185

Sequence Info:full length protein

View full details