Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein yfgG(yfgG)

Recombinant Uncharacterized protein yfgG(yfgG)

SKU:CSB-CF354920EOD

Regular price ¥250,100 JPY
Regular price Sale price ¥250,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P64546

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQATSMRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESP VQR

Protein Names:Recommended name: Uncharacterized protein yfgG

Gene Names:Name:yfgG Ordered Locus Names:Z3768, ECs3366

Expression Region:1-63

Sequence Info:full length protein

View full details