Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein ycf49(ycf49)

Recombinant Uncharacterized protein ycf49(ycf49)

SKU:CSB-CF323651DZX

Regular price ¥257,400 JPY
Regular price Sale price ¥257,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cyanophora paradoxa

Uniprot NO.:P15811

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVLSYFTWFVHLSSVLEWLNIIYFFLLYTKLKKNLSLKTFIFSFFISFCSALCACTLHF FNNQSFYYFLINLQSFLTLFANITLYFSILIYKQQILKNQNY

Protein Names:Recommended name: Uncharacterized protein ycf49 Alternative name(s): ORF102

Gene Names:Name:ycf49

Expression Region:1-102

Sequence Info:full length protein

View full details