Gene Bio Systems
Recombinant Uncharacterized protein ycf49(ycf49)
Recombinant Uncharacterized protein ycf49(ycf49)
SKU:CSB-CF874656DZV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cyanidium caldarium
Uniprot NO.:Q9TM18
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYSLSLPTWNIHIVTLVEWSIVIRLIYLFTYFYDIPRSFNFLIIILMIFFFLSGLFACCW HFFNNNSILLWISVAQAALTAFSNFFFLLFISAYYHK
Protein Names:Recommended name: Uncharacterized protein ycf49
Gene Names:Name:ycf49 Synonyms:ycf55
Expression Region:1-97
Sequence Info:full length protein
