Gene Bio Systems
Recombinant Uncharacterized protein ybfB(ybfB)
Recombinant Uncharacterized protein ybfB(ybfB)
SKU:CSB-CF359521EOD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O157:H7
Uniprot NO.:P0AAU6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSYGMMVICFPTGIVFFI ALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKRIINK
Protein Names:Recommended name: Uncharacterized protein ybfB
Gene Names:Name:ybfB Ordered Locus Names:Z0849
Expression Region:1-108
Sequence Info:full length protein
