
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q10010
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSETLSRLLIITAGTLYPAYRSYKAVRTKDTREYVKWMMYWIVFAIYSFLENLLDLVLAF WFPFYFQLKIVFIFWLLSPWTKGASILYRKWVHPTLNRHEKDIDALLESAKSESYNQLMR IGSKSLVYAKDVVAEAAVRGQQQLVNQLQRSYSANDVGSEREALTKNINIVKIEELDENS DTDLQKSPRPRRRASSRSRSRSRTIDSGADSEFTTAATIPRRSARKPIH
Protein Names:Recommended name: Uncharacterized protein T19C3.4
Gene Names:ORF Names:T19C3.4
Expression Region:1-229
Sequence Info:full length protein
You may also like
-
Recombinant Uncharacterized protein B0416.3(B0416.3)
- Regular price
- ¥178,100 JPY
- Sale price
- ¥178,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Uncharacterized protein ZK686.3 (ZK686.3)
- Regular price
- ¥192,600 JPY
- Sale price
- ¥192,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Uncharacterized FAM18-like protein C34D4.4(C34D4.4)
- Regular price
- ¥182,500 JPY
- Sale price
- ¥182,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Uncharacterized protein T28D9.3(T28D9.3)
- Regular price
- ¥193,900 JPY
- Sale price
- ¥193,900 JPY
- Regular price
-
- Unit price
- per
Sold out