Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv3395c-MT3502(Rv3395c, MT3502)

Recombinant Uncharacterized protein Rv3395c-MT3502(Rv3395c, MT3502)

SKU:CSB-CF687378MVZ

Regular price ¥276,900 JPY
Regular price Sale price ¥276,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:Q50730

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAAFASDQRLENGAEQLESLRRQMALLSEKVSGGPSRSGDLVPAGPVSLPPGTVGVLSG ARSLLLSMVASVTAAGGNAAIVGQPDIGLLAAVEMGADLSRLAVIPDPGTDPVEVAAVLI DGMDLVVLGLGGRRVTRARARAVVARARQKGCTLLVTDGDWQGVSTRLAARVCGYEITPA LRGVPTPGLGRISGVRLQINGRGR

Protein Names:Recommended name: Uncharacterized protein Rv3395c/MT3502

Gene Names:Ordered Locus Names:Rv3395c, MT3502 ORF Names:MTCY78.33

Expression Region:1-204

Sequence Info:full length protein

View full details