Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv2599-MT2674(Rv2599, MT2674)

Recombinant Uncharacterized protein Rv2599-MT2674(Rv2599, MT2674)

SKU:CSB-CF706517MVZ

Regular price ¥262,400 JPY
Regular price Sale price ¥262,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:Q50622

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AAVSLISGITLLNRDVGSYIASHYRQESRDVNGTRYLCTGSPKQVATTLVKYQTPAARAS HTDTEYLRYRNNIVTVGPDGTYPCIIRVENLSAGYNHGAYVFLGPGFTPGSPSGGSGGSP GGPGGSK

Protein Names:Recommended name: Uncharacterized protein Rv2599/MT2674

Gene Names:Ordered Locus Names:Rv2599, MT2674 ORF Names:MTCY227.02c

Expression Region:17-143

Sequence Info:full length protein

View full details