Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv1824-MT1872 (Rv1824, MT1872)

Recombinant Uncharacterized protein Rv1824-MT1872 (Rv1824, MT1872)

SKU:CSB-CF355002MVZ

Regular price ¥226,300 JPY
Regular price Sale price ¥226,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64893

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLE RIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFG A

Protein Names:Recommended name: Uncharacterized protein Rv1824/MT1872

Gene Names:Ordered Locus Names:Rv1824, MT1872 ORF Names:MTCY1A11.19c

Expression Region:1-121

Sequence Info:full length protein

View full details